Recombinant Rhesus monkey MCL1 Protein, His-tagged

• Cat.No.: MCL1-73R
• Product Overview: Recombinant Rhesus monkey MCL1 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Description: This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing.
• Source: E. coli
• Species: Rhesus monkey
• Tag: His
• Form: 50mM Tris, 300mM NaCl, pH 8.0.
• Molecular Mass: 39.3 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.1 mg/ml

Gene Information

• Gene Name: MCL1 MCL1 apoptosis regulator, BCL2 family member [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: MCL1
• Synonyms: TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT
• Gene ID: 707539
• mRNA Refseq: NM_001266501
• Protein Refseq: NP_001253430
• UniProt ID: F7HUE9