Recombinant Rhesus monkey IL2 Protein, His-SUMO/MYC-tagged
| Cat.No. : | IL2-1256R |
| Product Overview : | Recombinant Rhesus monkey IL2 Protein (21-154aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Rhesus monkey |
| Tag : | His&Myc&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 35.5 kDa |
| AA Sequence : | APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVL NLAQSKNFHLRDTKDLISNINVIVLELKGSETTLMCEYADETATIVEFLNRWITFCQSIISTLT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Protein length : | 21-154 a.a. |
| Gene Name | IL2 interleukin 2 [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | IL2 |
| Synonyms | IL-2; interleukin 2; IL2 |
| Gene ID | 708017 |
| mRNA Refseq | NM_001047130.1 |
| Protein Refseq | NP_001040595.1 |
| UniProt ID | P68291 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *
0
Inquiry Basket
