Recombinant Rhesus Macaque IL1A Protein (113-271 aa), His-SUMO-tagged
Cat.No. : | IL1A-577R |
Product Overview : | Recombinant Rhesus Macaque IL1A Protein (113-271 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 113-271 aa |
Description : | Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 34.1 kDa |
AA Sequence : | SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P48089 |
◆ Recombinant Proteins | ||
IL1A-2238R | Recombinant Rhesus monkey IL1A Protein, His-tagged | +Inquiry |
IL1A-8134M | Recombinant Mouse IL1A Protein | +Inquiry |
IL1A-5443H | Recombinant Human IL1A protein, His-tagged | +Inquiry |
IL1A-5444R | Recombinant Rhesus macaque IL1A protein, His-tagged | +Inquiry |
IL1A-501H | Active Recombinant Human IL1A protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *
0
Inquiry Basket