Recombinant Rhesus macaque EpCAM Protein, His-tagged

Cat.No. : EpCAM-225R
Product Overview : Recombinant Rhesus macaque EpCAM protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : HEK293
Tag : His
Protein Length : 314
Description : This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
Form : Lyophilized
Molecular Mass : 28.2 kDa
AA Sequence : MAPPQVLAFGLLLAAATASFAAAQKECVCENYKLAVNCFLNDNGQCQCTSIGAQNTVLCSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDVQSLRTALEEAIKTRYQLDPKFITNILYEDNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLRVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAIVAGIVVLVISRKKRMAKYEKAEIKEMGEIHRELNA
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name EPCAM epithelial cell adhesion molecule [ Macaca mulatta (Rhesus monkey) ]
Official Symbol EpCAM
Synonyms EPCAM; epithelial cell adhesion molecule; tumor-associated calcium signal transducer 1; Ep-CAM; TACSTD1;
Gene ID 677680
mRNA Refseq NM_001040029
Protein Refseq NP_001035118
UniProt ID Q1WER1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EpCAM Products

Required fields are marked with *

My Review for All EpCAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon