Recombinant Rhesus CXCL10 protein
Cat.No. : | CXCL10-65R |
Product Overview : | Recombinant Rhesus CXCL10 protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | Non |
Protein Length : | 77 |
Description : | CXCL10 also known as IP-10 is belonging to the CXC chemokine family. It is encoded by the CXCL10 gene. CXCL10 was originally identified in monocytes, endothelial cells and fibroblasts as a responsor to IFN-γ. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL10 has been shown to be a chemoattractant for activated T-lymphocytes and monocytes/macrophages. It also has other roles, such as promotion of T cell adhesion to endothelial cells, and inhibition of bone marrow colony formation and angiogenesis. The rhesus macaque IP-10 shares 69 %, 95 %, 74 % a.a. sequence identity with human, murine, rat IP-10. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10-50 ng/ml. |
Molecular Mass : | Approximately 8.7 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids. |
AA Sequence : | IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Endotoxin : | Less than 1 EU/µg of rRhIP-10/CXCL10 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL10 |
Official Symbol | CXCL10 |
Synonyms | Gamma-IP10, Small-inducible Cytokine B10 |
Gene ID | 574243 |
mRNA Refseq | NM_001032892.1 |
Protein Refseq | NP_001028064.1 |
UniProt ID | Q8MIZ1 |
◆ Recombinant Proteins | ||
CXCL10-240H | Recombinant Human X-C motif chemokine ligand 10 Protein, Tag Free | +Inquiry |
Cxcl10-39M | Recombinant Mouse Chemokine (C-X-C Motif) Ligand 10 | +Inquiry |
CXCL10-105H | Active Human CXCL10 | +Inquiry |
CXCL10-1508C | Recombinant Cynomolgus CXCL10 protein, His-tagged | +Inquiry |
CXCL10-31H | Recombinant Human CXCL10, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *
0
Inquiry Basket