Recombinant Rhesus CXCL10 protein

• Cat.No.: CXCL10-65R
• Product Overview: Recombinant Rhesus CXCL10 protein was expressed in E.coli.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: Non
• Protein Length: 77
• Description: CXCL10 also known as IP-10 is belonging to the CXC chemokine family. It is encoded by the CXCL10 gene. CXCL10 was originally identified in monocytes, endothelial cells and fibroblasts as a responsor to IFN-γ. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL10 has been shown to be a chemoattractant for activated T-lymphocytes and monocytes/macrophages. It also has other roles, such as promotion of T cell adhesion to endothelial cells, and inhibition of bone marrow colony formation and angiogenesis. The rhesus macaque IP-10 shares 69 %, 95 %, 74 % a.a. sequence identity with human, murine, rat IP-10.
• Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10-50 ng/ml.
• Molecular Mass: Approximately 8.7 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
• AA Sequence: IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
• Endotoxin: Less than 1 EU/µg of rRhIP-10/CXCL10 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CXCL10
• Official Symbol: CXCL10
• Synonyms: Gamma-IP10, Small-inducible Cytokine B10
• Gene ID: 574243
• mRNA Refseq: NM_001032892.1
• Protein Refseq: NP_001028064.1
• UniProt ID: Q8MIZ1