Recombinant Rhesus C-X-C motif chemokine ligand 16 Protein, His&SUMO tagged

• Cat.No.: CXCL16-255R
• Product Overview: Recombinant Rhesus CXCL16 Protein (51-228aa) with N-His&SUMO tag was expressed in E. coli.

Specification

• Description: Enables chemokine activity. Involved in several processes, including positive regulation of cell growth; response to interferon-gamma; and response to tumor necrosis factor. Located in extracellular space. Biomarker of COVID-19 and systemic scleroderma.
• Source: E. coli
• Species: Rhesus
• Tag: N-His&SUMO
• Protein length: 51-228aa
• Molecular Mass: 33.24 kDa
• AA Sequence: MNWSHPQFEKSSGSSGGHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIGGNEGTVTGSCHCSKRISSDSPPSAQFMNRLRKHLRAYHHCLHYIRFQLPSWSVCGGSKDPWVRELMSCLDLKECGHAYLGSVAHQEHLPPTSTPISQASEGASSDIRTPTQMLLSILQSTQCPTPPAGSLSLDKELTRPSETTIPTAGHSLGVGLEAGENQKQLKNNAGPTAGTSATVP
• Purity: > 85% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: 20 mM Tris-HCl, 0.10 M NaCl, pH8.0
• Concentration: 0.5 mg/mL

Gene Information

• Gene Name: CXCL16 C-X-C motif chemokine ligand 16 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: CXCL16
• Synonyms: CXCL16; C-X-C motif chemokine ligand 16; C-X-C motif chemokine 16
• Gene ID: 721566
• mRNA Refseq: XM_001117747
• Protein Refseq: XP_001117747
• UniProt ID: F7AGQ0