Recombinant Rat Tlr4 protein, His-SUMO & Myc-tagged
Cat.No. : | Tlr4-2401R |
Product Overview : | Recombinant Rat Tlr4 protein(Q9QX05)(26-638aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 26-638aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 90.2 kDa |
AA Sequence : | NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tlr4 toll-like receptor 4 [ Rattus norvegicus ] |
Official Symbol | Tlr4 |
Synonyms | TLR4; toll-like receptor 4; toll4; |
Gene ID | 29260 |
mRNA Refseq | NM_019178 |
Protein Refseq | NP_062051 |
◆ Recombinant Proteins | ||
TLR4-2447H | Recombinant Human TLR4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TLR4-1487H | Recombinant Human TLR4 Protein (Glu24-Lys631), N-His tagged | +Inquiry |
TLR4-886H | Active Recombinant Human TLR4 Protein, Ser & His-tagged | +Inquiry |
TLR4-4547R | Recombinant Rhesus Macaque TLR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tlr4-7620R | Recombinant Rat Tlr4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR4-402HCL | Recombinant Human TLR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tlr4 Products
Required fields are marked with *
My Review for All Tlr4 Products
Required fields are marked with *
0
Inquiry Basket