Recombinant Rat Sult1a1 Protein, His-SUMO/MYC-tagged
| Cat.No. : | Sult1a1-1379R |
| Product Overview : | Recombinant Rat Sult1a1 Protein (1-291aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Rat |
| Tag : | His&Myc&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 53.9 kDa |
| AA Sequence : | MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Protein length : | 1-291 a.a. |
| Gene Name | Sult1a1 sulfotransferase family 1A member 1 [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | Sult1a1 |
| Synonyms | Stm; Stp1; ASTIV; Mx-ST; PST-1; St1a1; Sult1a3; EC 2.8.2.1 |
| Gene ID | 83783 |
| mRNA Refseq | NM_031834.1 |
| Protein Refseq | NP_114022.1 |
| UniProt ID | P17988 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sult1a1 Products
Required fields are marked with *
My Review for All Sult1a1 Products
Required fields are marked with *
0
Inquiry Basket
