Recombinant Rat Slc25a18 Full Length Transmembrane protein, His-tagged

• Cat.No.: Slc25a18-1021R
• Product Overview: Recombinant Rat Slc25a18 protein(Q505J6)(1-320aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 1-320aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.7 kDa
• AA Sequence: MIACRMSSQDLSITAKLINGGIAGLVGVTCVFPIDLAKTRLQNQQGKDVYKGMTDCLVKTARAEGFLGMYRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGICQVVITCPMEMLKIQLQDAGRLAVCQQASASATPTSRPYSTGSTSTHRRPSATLIAWELLRTQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQLGVSELTGKASFTHSFVAGCAAGSVSAVAVTPLDVLKTRIQTLKKGLGEDTYRGVTDCARKLWTQEGAAAFMKGAGCRALVIAPLFGIAQGVYFIGIGERILKCFE-
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Slc25a18 solute carrier family 25 (mitochondrial carrier), member 18 [ Rattus norvegicus ]
• Official Symbol: Slc25a18
• Synonyms: SLC25A18; solute carrier family 25 (mitochondrial carrier), member 18; mitochondrial glutamate carrier 2; GC-2; glutamate/H(+) symporter 2; glutamate carrier 2, mitochondrial; solute carrier family 25 member 18; MGC105602
• Gene ID: 681896
• mRNA Refseq: NM_001044280
• Protein Refseq: NP_001037745