Recombinant Rat Slc17a7 protein, His-tagged

• Cat.No.: Slc17a7-4543R
• Product Overview: Recombinant Rat Slc17a7 protein(Q62634)(1-63aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Source: Yeast
• Species: Rat
• Tag: C-His
• Protein length: 1-63aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 8.8 kDa
• AASequence: MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLPRRY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Slc17a7 solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [ Rattus norvegicus ]
• Official Symbol: Slc17a7
• Synonyms: SLC17A7; solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7; vesicular glutamate transporter 1; solute carrier family 17 member 7; brain-specific Na-dependent inorganic phosphate cotransporter; brain-specific Na(+)-dependent inorganic phosphate cotransporter; BNPI; Vglut1
• Gene ID: 116638
• mRNA Refseq: NM_053859
• Protein Refseq: NP_446311