Recombinant Rat Slc17a6 protein, His-tagged

• Cat.No.: Slc17a6-3654R
• Product Overview: Recombinant Rat Slc17a6 protein(Q9JI12)(499-582aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Source: Yeast
• Species: Rat
• Tag: C-His
• Protein length: 499-582aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 11.1 kDa
• AASequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Slc17a6 solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 [ Rattus norvegicus ]
• Official Symbol: Slc17a6
• Synonyms: SLC17A6; solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6; vesicular glutamate transporter 2; differentiation-associated BNPI; solute carrier family 17 member 6; differentation-associated Na-dependent inorganic phosphate cotransporter; differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Dnpi; Vglut2
• Gene ID: 84487
• mRNA Refseq: NM_053427
• Protein Refseq: NP_445879