Recombinant Rat PTH1R Protein, His-tagged
Cat.No. : | PTH1R-4819R |
Product Overview : | Recombinant Rat PTH1R Protein, His-tagged, expressed in HEK293. |
Availability | April 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His |
Protein Length : | 27-188 aa |
Tag : | His |
Molecular Mass : | 20 kDa |
AA Sequence : | DADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAANIMESDKGWTPASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.11mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH7.4 |
Gene Name | Pth1r parathyroid hormone 1 receptor [ Rattus norvegicus (Norway rat) ] |
Official Symbol | PTH1R |
Synonyms | Pthr; Pthr1; PTHrel; PTH1R |
Gene ID | 56813 |
mRNA Refseq | NM_020073 |
Protein Refseq | NP_064458 |
UniProt ID | P25961 |
◆ Cell & Tissue Lysates | ||
PTH1R-1841HCL | Recombinant Human PTH1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTH1R Products
Required fields are marked with *
My Review for All PTH1R Products
Required fields are marked with *
0
Inquiry Basket