Recombinant Rat PTH1R Protein, His-tagged

• Cat.No.: PTH1R-4819R
• Product Overview: Recombinant Rat PTH1R Protein, His-tagged, expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 27-188 aa
• Tag: His
• Molecular Mass: 20 kDa
• AA Sequence: DADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAANIMESDKGWTPASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.11mg/ml by BCA
• Storage Buffer: Sterile PBS, pH7.4

Gene Information

• Gene Name: Pth1r parathyroid hormone 1 receptor [ Rattus norvegicus (Norway rat) ]
• Official Symbol: PTH1R
• Synonyms: Pthr; Pthr1; PTHrel; PTH1R
• Gene ID: 56813
• mRNA Refseq: NM_020073
• Protein Refseq: NP_064458
• UniProt ID: P25961