Recombinant Rat PRSS2 Protein (24-246 aa), His-tagged

• Cat.No.: PRSS2-2690R
• Product Overview: Recombinant Rat PRSS2 Protein (24-246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• Protein Length: 24-246 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.3 kDa
• AA Sequence: IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Prss2 protease, serine, 2 [ Rattus norvegicus ]
• Official Symbol: PRSS2
• Synonyms: PRSS2; anionic trypsin-2; pretrypsinogen II; serine protease 2; pancreatic trypsin II; Ptryss2
• Gene ID: 25052
• mRNA Refseq: NM_012729
• Protein Refseq: NP_036861
• UniProt ID: P00763