Recombinant Rat PCSK9 Protein, His-tagged

• Cat.No.: PCSK9-413R
• Product Overview: Recombinant Rat PCSK9 protein with His tag was expressed in HEK293.

Specification

• Description: Predicted to enable several functions, including lipoprotein particle binding activity; lipoprotein particle receptor binding activity; and serine-type endopeptidase activity. Involved in several processes, including cellular response to insulin stimulus; cholesterol homeostasis; and protein autoprocessing. Located in extracellular space and rough endoplasmic reticulum. Human ortholog(s) of this gene implicated in familial hypercholesterolemia and hypobetalipoproteinemia. Orthologous to human PCSK9 (proprotein convertase subtilisin/kexin type 9).
• Source: HEK293
• Species: Rat
• Tag: His
• Form: Lyophilized
• Molecular Mass: 73.2 kDa
• Protein length: 691
• AA Sequence: MGIRCSTWLRWPLSPQLLLLLLLCPTGSRAQDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQ
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Pcsk9 proprotein convertase subtilisin/kexin type 9 [ Rattus norvegicus ]
• Official Symbol: PCSK9
• Synonyms: PCSK9; proprotein convertase subtilisin/kexin type 9; proprotein convertase 9; proprotein convertase PC9; subtilisin/kexin-like protease PC9; neural apoptosis regulated convertase 1; neural apoptosis-regulated convertase 1; PC9; Narc1; NARC-1
• Gene ID: 298296
• mRNA Refseq: NM_199253
• Protein Refseq: NP_954862
• UniProt ID: P59996