Recombinant Rat PCSK9 Protein, His-tagged

Cat.No. : PCSK9-413R
Product Overview : Recombinant Rat PCSK9 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Protein Length : 691
Description : Predicted to enable several functions, including lipoprotein particle binding activity; lipoprotein particle receptor binding activity; and serine-type endopeptidase activity. Involved in several processes, including cellular response to insulin stimulus; cholesterol homeostasis; and protein autoprocessing. Located in extracellular space and rough endoplasmic reticulum. Human ortholog(s) of this gene implicated in familial hypercholesterolemia and hypobetalipoproteinemia. Orthologous to human PCSK9 (proprotein convertase subtilisin/kexin type 9).
Form : Lyophilized
Molecular Mass : 73.2 kDa
AA Sequence : MGIRCSTWLRWPLSPQLLLLLLLCPTGSRAQDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQ
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Pcsk9 proprotein convertase subtilisin/kexin type 9 [ Rattus norvegicus ]
Official Symbol PCSK9
Synonyms PCSK9; proprotein convertase subtilisin/kexin type 9; proprotein convertase 9; proprotein convertase PC9; subtilisin/kexin-like protease PC9; neural apoptosis regulated convertase 1; neural apoptosis-regulated convertase 1; PC9; Narc1; NARC-1;
Gene ID 298296
mRNA Refseq NM_199253
Protein Refseq NP_954862
UniProt ID P59996

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PCSK9 Products

Required fields are marked with *

My Review for All PCSK9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon