Recombinant Rat NEO1 Protein (1096-1377 aa), His-tagged

• Cat.No.: NEO1-2439R
• Product Overview: Recombinant Rat NEO1 Protein (1096-1377 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• Protein Length: 1096-1377 aa
• Description: Multi-functional cell surface receptor regulating cell adhesion in many diverse developmental processes, including neural tube and mammary gland formation, myogenesis and angiogenesis. Receptor for members of the BMP, netrin, and repulsive guidance molecule (RGM) families. Netrin-Neogenin interactions result in a chemoattractive axon guidance response and cell-cell adhesion, the interaction between NEO1/Neogenin and RGMa and RGMb induces a chemorepulsive response.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.0 kDa
• AA Sequence: CTRRTTSHQKKKRAACKSVNGSHKYKGNCKDVKPPDLWIHHERLELKPIDKSPDPNPVMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQQSVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPIYDPALPSTPLLSQQALNHHLHSVKTASIGTLGRSRPPMPVVVPSAPEVQEATRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Neo1 neogenin 1 [ Rattus norvegicus ]
• Official Symbol: NEO1
• Synonyms: NEO1; neogenin 1; neogenin
• Gene ID: 81735
• mRNA Refseq: NM_001191881
• UniProt ID: P97603