Recombinant Rat Mfge8 protein(23-427aa), His-tagged

• Cat.No.: Mfge8-669R
• Product Overview: Recombinant Rat Mfge8 protein(P70490)(23-427aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Rat
• Tag: His
• Protein length: 23-427aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.1 kDa
• AASequence: ASGDFCDSSLCLNGGTCLMGQDNDIYCLCPEGFTGLVCNETEKGPCSPNPCFHDAKCLVTEDTQRGDIFTEYICQCPVGYSGIHCELGCSTKLGLEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASSYDSKPWIQVDFLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRRFEFIQDESGTGDKEFMGNQDNNSLKINMFNPTLEAQYIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQITASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQKKVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGTSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPLSWHNRITLRLELLGC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Mfge8 milk fat globule-EGF factor 8 protein [ Rattus norvegicus ]
• Official Symbol: Mfge8
• Synonyms: MFGE8; milk fat globule-EGF factor 8 protein; lactadherin; MFGM; SED1; MFG-E8; O-acetyl GD3 ganglioside synthase; O-acetyl disialoganglioside synthase; O-acetyltransferase milk fat globule membrane protein; O-acetyltransferase Milk fat glolbule membrane protein; AGS; MFGME8; OAcGD3S; MFGMP-E8
• Gene ID: 25277
• mRNA Refseq: NM_001040186
• Protein Refseq: NP_001035276