Recombinant Rat Metrnl protein, His-tagged
Cat.No. : | Metrnl-563R |
Product Overview : | Recombinant Rat Metrnl protein(Q5RJL6)(46-311aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 46-311aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QYSSDLCSWKGSGLTREAHSKEVEQVYLRCSAGSVEWMYPTGALIVNLRPNTFSPAQNLTVCIKPFRDSSGANIYLEKTGELRLLVRDVRGEPGQVQCFSLEQGGLFVEATPQQDISRRTTGFQYELMSGQRGLDLHVLSAPCRPCSDTEVLLAICTSDFVVRGFIEDVTHVPEQQVSVIHLRVSRLHRQKSRVFQPAPEDSGHWLGHVTTLLQCGVRPGHGEFLFTGHVHFGEAQLGCAPRFSDFQKMYRKAEERGINPCEINME |
◆ Recombinant Proteins | ||
Metrnl-6754M | Recombinant Mouse Metrnl Protein (Glu67-Glu311), N-His tagged | +Inquiry |
METRNL-2094M | Recombinant Mouse METRNL Protein (46-311 aa), His-tagged | +Inquiry |
METRNL-3312R | Recombinant Rat METRNL Protein, His (Fc)-Avi-tagged | +Inquiry |
METRNL-3928H | Recombinant Human METRNL protein(46-311aa), GST-tagged | +Inquiry |
METRNL-2527R | Recombinant Rat METRNL Protein (46-311 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Metrnl Products
Required fields are marked with *
My Review for All Metrnl Products
Required fields are marked with *
0
Inquiry Basket