Recombinant Rat Lif protein

• Cat.No.: Lif-733R
• Product Overview: Recombinant Rat Lif protein was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 180
• Description: A secreted cytokine, involved in embryonic stem cell and myeloid cell growth and differentiation and stimulation of bone remodeling.
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in 1 × PBS, pH 7.4.
• Molecular Mass: Approximately 19.8 kDa, a single non-glycosylated polypeptide chain containing 180 amino acids.
• AA Sequence: SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF
• Endotoxin: Less than 0.1 EU/μg of rRtLIF as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Lif
• Official Symbol: Lif
• Synonyms: LIF; leukemia inhibitory factor; cholinergic neuronal differentiation factor; leukemia inhibitory factor (cholinergic differentiation factor)
• Gene ID: 60584
• mRNA Refseq: NM_022196
• Protein Refseq: NP_071532
• UniProt ID: P17777