Recombinant Rat LEP Protein

Cat.No. : LEP-203R
Product Overview : Recombinant Rat LEP Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Description : Leptin is a hormone that is produced by adipose tissue and plays critical roles in the physiologic regulation of body weight. Leptin acts through the leptin receptor (LEPR) to regulate adipose mass by inhibiting hunger and balancing energy usage. Leptin mutations cause severe hereditary obesity and hypogonadism in rodents and humans. Leptin also has thermogenic actions, regulates enzymes of fatty acid oxidation, and is involved in hematopoiesis, angiogenesis, wound healing, inflammation, and immune responses.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 16.3 kDa (147 aa)
AA Sequence : MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Lep leptin [ Rattus norvegicus (Norway rat) ]
Official Symbol LEP
Synonyms LEP; leptin; obesity factor; OB; obese;
Gene ID 25608
mRNA Refseq NM_013076
Protein Refseq NP_037208
UniProt ID P50596

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LEP Products

Required fields are marked with *

My Review for All LEP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon