Recombinant Rat INS1 Protein (25-54 aa), His-SUMO-tagged

• Cat.No.: INS1-2436R
• Product Overview: Recombinant Rat INS1 Protein (25-54 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 25-54 aa
• Description: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.4 kDa
• AA Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKS
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Ins1 insulin 1 [ Rattus norvegicus ]
• Official Symbol: INS1
• Synonyms: INS1; insulin 1; insulin-1
• Gene ID: 24505
• mRNA Refseq: NM_019129
• Protein Refseq: NP_062002
• UniProt ID: P01322