Recombinant Rat IL-17AF Heterodimer Protein
Cat.No. : | IL17A-142R |
Product Overview : | Recombinant Rat IL-17AF Heterodimer Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Interleukin 17AF (IL-17AF) is a heterodimer that is composed of the interleukin 17A (IL-17A) and interleukin 17F (IL-17F) members of the IL-17 family of cytokines. IL-17AF is produced by T helper 17 cells (Th17) following interleukin 23 (IL-23) stimulation. IL-17AF signals through the IL-17RA/IL-17RC receptor complex and functions to regulate inflammatory responses. IL-17AF induces chemokine and airway neutrophilia production, similar in function to IL-17A and IL-17F homodimers. In regard to these functions, IL-17AF is less active than the IL-17A homodimer and shows greater activity than the IL-17F homodimer. Human and rat IL-17AF are active on mouse cells. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Dimer, 30.2 kDa ((IL-17A=134; IL-17F=135; Total=269 amino acids) aa) |
AA Sequence : | IL-17A: MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS IL-17F: MARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Il17a interleukin 17A [ Rattus norvegicus (Norway rat) ] |
Official Symbol | IL17A |
Synonyms | IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); Il17; IL-17; CTLA-8; IL-17A; |
Gene ID | 301289 |
mRNA Refseq | NM_001106897 |
Protein Refseq | NP_001100367 |
UniProt ID | Q61453 |
◆ Recombinant Proteins | ||
IL17A-26H | Recombinant Human Interleukin-17 | +Inquiry |
IL17A-288H | Recombinant Human IL17A, StrepII-tagged | +Inquiry |
IL17A-97H | Recombinant Human IL-17A | +Inquiry |
Il17a-680R | Active Recombinant Rat Il17a | +Inquiry |
Il17a-094M | Active Recombinant Mouse Il17a Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket