Description :	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Three alternatively spliced variants encoding different isoforms have been described.
Source :	E. coli
Species :	Rat
Form :	Lyophilized
Bio-activity :	Determined by a cell proliferation assay using balb/c 3T3 cells. The expected ED50 is ≤ 0.1 ng/mL, in the presence of 10 μg/mL heparin, corresponding to a specific activity of ≥ 1 x 107 units/mg.
Molecular Mass :	15.9 kDa
AA Sequence :	MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin :	Endotoxin level is < 0.1 ng/μg (< 1 EU/μg).
Purity :	95%
Applications :	Functional Study SDS-PAGE
Usage :	Activity assay SDS-PAGE The optimal working dilution should be determined by the end user.
Storage :	Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	Lyophilized from solutions contain no sodiun azide nor carrier protein
Tag :	Non

Gene Name	Fgf1 fibroblast growth factor 1 [ Rattus norvegicus ]
Official Symbol	Fgf1
Synonyms	FGF1; fibroblast growth factor 1; aFGF; acidic fibroblast growth factor; heparin-binding growth factor 1; Fibroblast growth factor 1 (heparin binding); FGF-1; HBGF1; HBGF-1;
Gene ID	25317
mRNA Refseq	NM_012846
Protein Refseq	NP_036978