Recombinant Rat FETUB Protein (19-378 aa), His-tagged

• Cat.No.: FETUB-2116R
• Product Overview: Recombinant Rat FETUB Protein (19-378 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• Protein Length: 19-378 aa
• Description: Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona pellucida hardening.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 41.7 kDa
• AA Sequence: RSPPAPPLPNAPFAPLRPLGCNDSEVLAVAGFALQNINRVQKDGYMLTLNRVHDARVHRQEDMGSLFYLMLDVLETGCHVLSRKALKDCGPRIFYETVHGQCKAMFHVNKPRRVLYLPAYNCTLRPVSKRKIHSMCPDCPHPVDLSAPSVLEAATESLAKFNSENPSKQYALVKVTKATTQWVVGPSYFVEYLIKESPCTQSQDSCSLQASDSEPVGLCQGSLIKSPGVPPQRFKKTVTVSCEFFESQDQVPGGENPADTQDAKKLPQKNTAPTSSPSITAPRGSIQHLPEQEEPEDSKGKSPEEPFPVQLDLTTNPQGDTLDVSFLYLEPEEKKLVVLPFPGKEQRSPECPGPEKQRTP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Fetub fetuin B [ Rattus norvegicus ]
• Official Symbol: FETUB
• Synonyms: FETUB; fetuin B; fetuin-B; IRL685; fetuin beta; Fet; Pp63
• Gene ID: 83928
• mRNA Refseq: NM_053348
• Protein Refseq: NP_445800
• UniProt ID: Q9QX79