Recombinant Rat Efna1 protein, His-tagged
Cat.No. : | Efna1-2837R |
Product Overview : | Recombinant Rat Efna1 protein(P97553)(18-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-182aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.4 kDa |
AA Sequence : | ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGHS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Efna1 ephrin A1 [ Rattus norvegicus ] |
Official Symbol | Efna1 |
Synonyms | EFNA1; ephrin A1; ephrin-A1; LERK-1; immediate early response protein B61; EPH-related receptor tyrosine kinase ligand 1; B61; |
Gene ID | 94268 |
mRNA Refseq | NM_053599 |
Protein Refseq | NP_446051 |
◆ Recombinant Proteins | ||
EFNA1-1386H | Recombinant Human EFNA1 Protein, MYC/DDK-tagged | +Inquiry |
EFNA1-328H | Active Recombinant Human EFNA1 protein, hFc-tagged | +Inquiry |
EFNA1-229H | Recombinant Human EFNA1 Protein, Fc-tagged | +Inquiry |
EFNA1-2032H | Recombinant Human EFNA1 Protein (Asp19-Ser182), N-His tagged | +Inquiry |
EFNA1-2060H | Recombinant Human Ephrin-A1, Fc Chimera | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA1-1514RCL | Recombinant Rat EFNA1 cell lysate | +Inquiry |
EFNA1-2594HCL | Recombinant Human EFNA1 cell lysate | +Inquiry |
EFNA1-2177MCL | Recombinant Mouse EFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Efna1 Products
Required fields are marked with *
My Review for All Efna1 Products
Required fields are marked with *
0
Inquiry Basket