Recombinant Rat Ctf1 protein

• Cat.No.: Ctf1-1174R
• Product Overview: Recombinant Rat Ctf1 protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 203
• Description: Cardiotrophin­1 (CT­1) is a member of the cytokine family which also includes IL-6, IL-11, leukemia inhibitory factor (LIF), oncostatin M (OSM), and ciliary neurotrophic factor (CNTF). CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung. Studies showed CT-1 which induces cardiac myocyte hypertrophy in vitro can bind to and activate the ILST/gp130 receptor. Rat CT­1 encodes a 203 amino acid (a.a.) residue protein that lacks a hydrophobic signal peptide and it shares 94% a.a. and 79% a.a. sequence identity with human and murine CT-1.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile, 0.1 % TFA.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 21.4 kDa, a single non-glycosylated polypeptide chain containing 203 amino acids.
• AA Sequence: MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPGGVA
• Endotoxin: Less than 1 EU/μg of rRtCT-1 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ctf1
• Official Symbol: Ctf1
• Synonyms: CTF1; cardiotrophin 1; cardiotrophin-1; CT-1
• Gene ID: 29201
• mRNA Refseq: NM_017129
• Protein Refseq: NP_058825
• UniProt ID: Q63086