Recombinant Rat CCL7 Protein

• Cat.No.: CCL7-33R
• Product Overview: Recombinant Rat CCL7 Protein without tag was expressed in E. coli.

Specification

• Description: Monocyte chemotactic protein 3 (MCP-3), also called CCL7, is produced by macrophages and tumor cell lines. MCP-3 signals through the G protein-coupled receptors CCR1, CCR2, and CCR3. MCP-3 chemoattracts monocytes and regulates macrophage function during inflammation and metastasis.
• Source: E. coli
• Species: Rat
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 8.5 kDa (74 aa)
• AA Sequence: QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Ccl7 chemokine (C-C motif) ligand 7 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: CCL7
• Synonyms: CCL7; chemokine (C-C motif) ligand 7; C-C motif chemokine 7; MCP-3; chemotactic protein-3; small-inducible cytokine A7; monocyte chemotactic protein 3; monocyte chemoattractant protein 3
• Gene ID: 287561
• mRNA Refseq: NM_001007612
• Protein Refseq: NP_001007613
• UniProt ID: Q9QXY8