Recombinant Rat Ccl7 protein

• Cat.No.: Ccl7-635R
• Product Overview: Recombinant Rat Ccl7 protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 74
• Description: Rat CCL7, belonging to the CC chemokine family, is also named as MCP-3, because the sequence comparison suggested that the rat CCL7 is a homologue of the human MCP-3 and is postulated the rat MCP-3. The MCP-3 protein family signals through CCR2 expect MCP-1 and possess cross-reacts across species. CCL7/MCP3 has chemotactic functions for monocytes and eosinophils, but not for neutrophils. Additionally, it can activated NK cells as well as CD4+ and CD8+ T lymphocytes. CCL7 was found to interact with MMP2.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.
• Molecular Mass: Approximately 8.5 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
• AA Sequence: QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP
• Endotoxin: Less than 1 EU/µg of rRtMCP-3/CCL7 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl7
• Official Symbol: Ccl7
• Synonyms: CCL7; chemokine (C-C motif) ligand 7; C-C motif chemokine 7; MCP-3; chemotactic protein-3; small-inducible cytokine A7; monocyte chemotactic protein 3; monocyte chemoattractant protein 3
• Gene ID: 287561
• mRNA Refseq: NM_001007612
• Protein Refseq: NP_001007613
• UniProt ID: Q9QXY8