Recombinant Rat CCL3 Protein

• Cat.No.: CCL3-24R
• Product Overview: Recombinant Rat CCL3 Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Description: Macrophage inflammatory protein-1 alpha (MIP-1 α), also known as CCL3, is a cytokine produced by macrophages. MIP-1 α binds the chemokine receptors CCR1, CCR4 and CCR5 to induce inflammatory responses, including the recruitment of granulocytes and neutrophil superoxide production. The MIP-1 α and MIP-1 β heterodimer exhibits antiviral activity against the human immunodeficiency virus 1 (HIV-1).
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Noncovalently-linked dimers, 7.9 kDa (69 aa)
• AA Sequence: APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Ccl3 chemokine (C-C motif) ligand 3 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: CCL3
• Synonyms: CCL3; chemokine (C-C motif) ligand 3; C-C motif chemokine 3; MIP-1-alpha; small inducible cytokine A3; small-inducible cytokine A3; macrophage inflammatory protein 1-alpha; Macrophage inflammatory protein 1 alpha (Small inducible cytokine A3); Scya3; MIP-1a
• Gene ID: 25542
• mRNA Refseq: NM_013025
• Protein Refseq: NP_037157
• UniProt ID: P50229