Recombinant Rat Ccl3 protein

• Cat.No.: Ccl3-56R
• Product Overview: Recombinant Rat Ccl3 protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 69
• Description: This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human blood monocytes is in a concentration range of 10-100 ng/ml.
• Molecular Mass: Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
• AA Sequence: APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA
• Endotoxin: Less than 0.1 EU/µg of rRtMIP-1α/CCL3 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl3
• Official Symbol: Ccl3
• Synonyms: CCL3; chemokine (C-C motif) ligand 3; C-C motif chemokine 3; MIP-1-alpha; small inducible cytokine A3; small-inducible cytokine A3; macrophage inflammatory protein 1-alpha; Macrophage inflammatory protein 1 alpha (Small inducible cytokine A3); Scya3; MIP-1a
• Gene ID: 25542
• mRNA Refseq: NM_013025
• Protein Refseq: NP_037157
• UniProt ID: P50229