Recombinant Rat Bglap Protein, GST-tagged
| Cat.No. : | Bglap-1143R |
| Product Overview : | Recombinant Rat Bglap Protein (50-99aa) was expressed in E. coli with N-terminal GST-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Rat |
| Tag : | GST |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 32.6 kDa |
| AA Sequence : | YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Protein length : | 50-99 a.a. |
| Gene Name | Bglap Bone gamma-carboxyglutamate protein [ Rattus norvegicus ] |
| Official Symbol | Bglap |
| Synonyms | BGLAP; Bone gamma-carboxyglutamate protein |
| Gene ID | 25295 |
| mRNA Refseq | NM_013414 |
| Protein Refseq | NP_038200 |
| UniProt ID | P04640 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bglap Products
Required fields are marked with *
My Review for All Bglap Products
Required fields are marked with *
0
Inquiry Basket
