Recombinant Rat Bglap Protein, GST-tagged
Cat.No. : | Bglap-1143R |
Product Overview : | Recombinant Rat Bglap Protein (50-99aa) was expressed in E. coli with N-terminal GST-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | GST |
Protein Length : | 50-99 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 32.6 kDa |
AA Sequence : | YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Bglap Bone gamma-carboxyglutamate protein [ Rattus norvegicus ] |
Official Symbol | Bglap |
Synonyms | BGLAP; Bone gamma-carboxyglutamate protein |
Gene ID | 25295 |
mRNA Refseq | NM_013414 |
Protein Refseq | NP_038200 |
UniProt ID | P04640 |
◆ Recombinant Proteins | ||
BGLAP-2141H | Recombinant Human BGLAP Protein, His-tagged | +Inquiry |
BGLAP-1475H | Recombinant Human BGLAP protein, MYC/DDK-tagged | +Inquiry |
BGLAP-204H | Recombinant Human BGLAP Protein, His-Flag-tagged | +Inquiry |
Bglap-707M | Recombinant Mouse Bglap Protein, MYC/DDK-tagged | +Inquiry |
BGLAP-5468Z | Recombinant Zebrafish BGLAP | +Inquiry |
◆ Native Proteins | ||
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGLAP-8460HCL | Recombinant Human BGLAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bglap Products
Required fields are marked with *
My Review for All Bglap Products
Required fields are marked with *
0
Inquiry Basket