Recombinant Rat ATPIF1 Protein, His-tagged
Cat.No. : | ATPIF1-13R |
Product Overview : | Recombinant Rat ATPIF1 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Description : | Enables ATPase inhibitor activity. Predicted to be involved in several processes, including mitochondrial depolarization; negative regulation of ATPase activity; and regulation of protein targeting to mitochondrion. Predicted to act upstream of or within positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway and reactive oxygen species metabolic process. Located in mitochondrion. Orthologous to human ATP5IF1 (ATP synthase inhibitory factor subunit 1). |
Form : | 50 mM Tris, 300 mM NaCl, pH 8.0 |
Molecular Mass : | 14.4 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAGSALAVRARLGVWGMRVLQTRGFGSDSSESMDSGAGSIREAGGAFGKREKAEEDRYFREKTREQLAALKKHHEDEIDHHSKEIERLQKQIERHKKKIKYLKNSEH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.1 mg/ml |
Gene Name | Atp5if1 ATP synthase inhibitory factor subunit 1 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Atp5if1 |
Synonyms | Atpi; IF1PA; Atpif1 |
Gene ID | 25392 |
mRNA Refseq | NM_012915 |
Protein Refseq | NP_037047 |
MIM | 614981 |
UniProt ID | Q03344 |
◆ Recombinant Proteins | ||
ATPIF1-1508HF | Recombinant Full Length Human ATPIF1 Protein, GST-tagged | +Inquiry |
ATPIF1-1025H | Recombinant Human ATPIF1 protein, GST-tagged | +Inquiry |
ATPIF1-475R | Recombinant Rhesus monkey ATPIF1 Protein, His-tagged | +Inquiry |
Atpif1-3764R | Recombinant Rat Atpif1, GST-tagged | +Inquiry |
Atpif1-677M | Recombinant Mouse Atpif1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATPIF1-8568HCL | Recombinant Human ATPIF1 293 Cell Lysate | +Inquiry |
ATPIF1-8569HCL | Recombinant Human ATPIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATPIF1 Products
Required fields are marked with *
My Review for All ATPIF1 Products
Required fields are marked with *
0
Inquiry Basket