Recombinant Raphanus sativus Protein, His-SUMO-tagged

• Cat.No.: AFP2-1110R
• Product Overview: Recombinant Raphanus sativus Protein (30-80aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Species: Raphanus sativus
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 30-80 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 21.7 kDa
• AA Sequence: QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: defensin-like protein 2 [ Raphanus sativus (radish) ]
• Official Symbol: AFP2
• Synonyms: AFP2; defensin-like protein 2; Rs-AFP2; antifungal protein 2 preprotein
• Gene ID: 108832239
• UniProt ID: P30230