Recombinant Rainbow trout cyp1a1 protein, His&Myc-tagged
Cat.No. : | cyp1a1-5321R |
Product Overview : | Recombinant Rainbow trout cyp1a1 protein(Q92110)(149-465aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rainbow trout |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 149-465a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SFATLEGTTPEYSCALEEHVCKEGEYLVKQLTSVMDVSGSFDPFRHIVVSVANVICGMCFGRRYSHDDQELLGLVNMSDEFGQVVGSGNPADFIPILRYLPNRTMKRFMDINDRFNNFVQKIVSEHYESYDKDNIRDITDSLIDHCEDRKLDENANIQVSDEKIVGIVNDLFGAGFDTISTALSWAVVYLVAYPEIQERLHQELKEKVGMIRTPRLSDKINLPLLEAFILEIFRHSSFLPFTIPHCTIKDTSLNGYFIPKDTCVFINQWQVNHDPELWKEPSSFNPDRFLSADGTELNKLEGEKVLVFGMDKRRCIG |
◆ Recombinant Proteins | ||
CYP1A1-1901H | Recombinant Human CYP1A1 Protein (Met1-Ala250), His tagged | +Inquiry |
Cyp1a1-2412M | Recombinant Mouse Cyp1a1 Protein, Myc/DDK-tagged | +Inquiry |
CYP1A1-6703C | Recombinant Chicken CYP1A1 | +Inquiry |
Cyp1a1-7964R | Recombinant Rat Cyp1a1 protein, His & GST-tagged | +Inquiry |
CYP1A1-1136R | Recombinant Rhesus monkey CYP1A1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP1A1-7126HCL | Recombinant Human CYP1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cyp1a1 Products
Required fields are marked with *
My Review for All cyp1a1 Products
Required fields are marked with *
0
Inquiry Basket