Recombinant Rabbit TIGIT Protein, Fc-tagged
Cat.No. : | TIGIT-732R |
Product Overview : | Recombinant Rabbit TIGIT protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 245 |
Description : | This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses. |
Form : | Lyophilized |
Molecular Mass : | 40.4 kDa |
AA Sequence : | MHWCFLLIWAQGLRQAPLLASGTMASMIVTTGNISAEEGGSAILQCHLSSTTTEVTQVNWEQQDRLLAVRHVDLGWHISPAFKERVVPGPSLSLTLLALTVNDTGEYFCTYHTYPDGIYKGRIFLEVRGSSVAEHSIGFQIPLFGAMATVLVVTCMVVLGVAALSRKKQFLRIHSAESGPRRTSAEQEERGPSVPSSLESCVQAATAPADLCLEQRGDDYDEPHDYFNVLSYRSLGSISFLAETG |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | LOC100343230 T cell immunoreceptor with Ig and ITIM domains [ Oryctolagus cuniculus (rabbit) ] |
Official Symbol | TIGIT |
Synonyms | LOC100343230; T cell immunoreceptor with Ig and ITIM domains; TIGIT; T-cell immunoreceptor with Ig and ITIM domains |
Gene ID | 100343230 |
mRNA Refseq | XM_002716684 |
Protein Refseq | XP_002716730 |
UniProt ID | G1SLC1 |
◆ Recombinant Proteins | ||
TIGIT-205R | Recombinant Rat TIGIT protein, Fc-tagged | +Inquiry |
TIGIT-23H | Recombinant Human TIGIT Protein | +Inquiry |
TIGIT-728H | Recombinant Human TIGIT Protein, Fc-tagged | +Inquiry |
TIGIT-235HFL | Recombinant Full Length Human TIGIT Protein, C-Flag-tagged | +Inquiry |
Tigit-7407MAF647 | Recombinant Mouse Tigit Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIGIT-1420MCL | Recombinant Mouse TIGIT cell lysate | +Inquiry |
TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIGIT Products
Required fields are marked with *
My Review for All TIGIT Products
Required fields are marked with *
0
Inquiry Basket