Recombinant Pseudomonas aeruginosa PA3340 Protein
Cat.No. : | PA3340-133P |
Product Overview : | Recombinant Pseudomonas aeruginosa PA3340 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Description : | hypothetical protein |
Form : | Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl. |
Molecular Mass : | ~35 kDa |
AA Sequence : | LGVGDIILHSALNQPLDADIELLDVGDLGADEIEVRLAGADVFAAAGVERLQFLNELRFSPVLQGRGGNRIHVSSIRPVQEPYLNFLVEVARPNGRIVREFTVLLDPLGYTPRMLPAARSGIEPQRQSSTPVPAPRSAAVVVDPALLEPGDEYLARPSDNLWAISGRLRGAGNADRAQLMEALYQLNPQAFVNADRHRLKAGARLRLPAGYQPERGAPGAVKEAAVEVLPPADAAVVENAPAALVEAQRQADAEAEALARQREELSQRMDDLQRQLQALQEQLQQRDHQVAELQQQLARRQAVRPAAPPPAAAAPSVAQPVETPTDSQ |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.5 mg/ml |
Gene Name | PA3340 hypothetical protein [ Pseudomonas aeruginosa PAO1 ] |
Official Symbol | PA3340 |
Gene ID | 882505 |
Protein Refseq | NP_252030 |
UniProt ID | Q9HYQ5 |
◆ Recombinant Proteins | ||
EML2-2880H | Recombinant Human EML2 Protein (Gly375-Val649), N-His tagged | +Inquiry |
TRAPPC1-6261R | Recombinant Rat TRAPPC1 Protein | +Inquiry |
RFL4499HF | Recombinant Full Length Human Adp-Ribosylation Factor-Like Protein 6-Interacting Protein 6(Arl6Ip6) Protein, His-Tagged | +Inquiry |
HBV-1049V | Recombinant Hepatitis B virus pre-S1 Protein | +Inquiry |
CED055 | Active Porcine D-Amino Acid Oxidase | +Inquiry |
◆ Native Proteins | ||
C1QA-26126TH | Native Human C1QA | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
CGA-8356H | Native Human CGA | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOLPH3L-5832HCL | Recombinant Human GOLPH3L 293 Cell Lysate | +Inquiry |
IGFBP4-2925MCL | Recombinant Mouse IGFBP4 cell lysate | +Inquiry |
PKN2-3150HCL | Recombinant Human PKN2 293 Cell Lysate | +Inquiry |
PAK2-1276HCL | Recombinant Human PAK2 cell lysate | +Inquiry |
TLR6-1044HCL | Recombinant Human TLR6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PA3340 Products
Required fields are marked with *
My Review for All PA3340 Products
Required fields are marked with *
0
Inquiry Basket