Recombinant Protein Human XDH Protein, 1234-1332, N-GST tagged

• Cat.No.: XDH-43H
• Product Overview: Human XDH partial ORF ( NP_000370, 1234 a.a. - 1332 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Description: Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Xanthine dehydrogenase can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism.
• Source: Wheat Germ (in vitro)
• Species: Human
• Tag: GST
• Protein length: 1234-1332
• Molecular Mass: 36.63 kDa
• AA Sequence: GSIPIEFRVSLLRDCPNKKAIYASKAVGEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWSVR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: XDH xanthine dehydrogenase [ Homo sapiens (human) ]
• Official Symbol: XDH
• Synonyms: XDH; xanthine dehydrogenase; xanthene dehydrogenase; xanthine dehydrogenase/oxidase; XO; XOR; xanthine oxidase; xanthine oxidoreductase
• Gene ID: 7498
• mRNA Refseq: NM_000379
• Protein Refseq: NP_000370
• MIM: 607633
• UniProt ID: P47989