Recombinant Porcine parvovirus Capsid protein VP2, His&Myc-tagged
Cat.No. : | VP2-7843P |
Product Overview : | Recombinant Porcine parvovirus (strain Kresse) Capsid protein VP2(P52501)(2-283aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine parvovirus |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-283a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGSFNNQTEFQYLGEGLVRITAHASRLIHLNMPEHETYKRIHVLNSESGVAGQMVQDDAHTQMVTPWSLIDANAWGVWFNPADWQLISNNMTEINLVSFEQEIFNVVLKTITESATSPPTKIYNNDLTASLMVALDTNNTLPYTPAAPRSETLGFYPWLPTKPTQYRYYLSCTRNLNPPTYTGQSQQITDSIQTGLHSDIMFYTIENAVPIHLLRTGDEFSTGIYHFDTKPLKLTHSWQTN |
◆ Recombinant Proteins | ||
VP2-1808M | Recombinant MPV-2 VP2 Protein | +Inquiry |
VP2-1799A | Recombinant AAV-2 VP2 Protein | +Inquiry |
VP2-765C | Recombinant Canine parvovirus type 2 Capsid protein VP2, partial, His-tagged | +Inquiry |
VP2-04A | Recombinant AAV-2 VP2 Protein, Strep/SUMO/His-tagged | +Inquiry |
VP2-1804A | Recombinant AAV-7 VP2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VP2 Products
Required fields are marked with *
My Review for All VP2 Products
Required fields are marked with *
0
Inquiry Basket