Recombinant Pongo Abelii TMEM168 Protein (527-637 aa), His-Myc-tagged

Cat.No. : TMEM168-2625P
Product Overview : Recombinant Pongo Abelii (Sumatran orangutan) (Pongo pygmaeus abelii) TMEM168 Protein (527-637 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His&Myc
Protein Length : 527-637 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.8 kDa
AA Sequence : EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name TMEM168 transmembrane protein 168 [ Pongo abelii (Sumatran orangutan) ]
Official Symbol TMEM168
Synonyms TMEM168;
Gene ID 100172041
mRNA Refseq NM_001131682
Protein Refseq NP_001125154
UniProt ID Q5RD28

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMEM168 Products

Required fields are marked with *

My Review for All TMEM168 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon