Recombinant Pongo Abelii TMEM168 Protein (527-637 aa), His-Myc-tagged

• Cat.No.: TMEM168-2625P
• Product Overview: Recombinant Pongo Abelii (Sumatran orangutan) (Pongo pygmaeus abelii) TMEM168 Protein (527-637 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 527-637 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.8 kDa
• AA Sequence: EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: TMEM168 transmembrane protein 168 [ Pongo abelii (Sumatran orangutan) ]
• Official Symbol: TMEM168
• Synonyms: TMEM168
• Gene ID: 100172041
• mRNA Refseq: NM_001131682
• Protein Refseq: NP_001125154
• UniProt ID: Q5RD28