Recombinant Pig PF4 protein, mFc-tagged
Cat.No. : | PF4-647P |
Product Overview : | Recombinant Pig PF4 protein(P30034)(1-90aa), fused with N-terminal mFc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Yeast |
Tag : | mFc |
Protein Length : | 1-90aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QEWSLPGTRVPPPADPEGGDANLRCVCVKTISGVSPKHISSLEVIGAGPHCPSPQLIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA |
◆ Recombinant Proteins | ||
PF4-150H | Recombinant Human PF4 Protein, His-tagged | +Inquiry |
PF4-2400R | Recombinant Rabbit PF4 Protein, His-tagged | +Inquiry |
PF4-590H | Recombinant Human platelet factor 4, His-tagged | +Inquiry |
PF4-901B | Recombinant Bovine PF4 protein | +Inquiry |
Pf4-4804M | Recombinant Mouse Pf4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
PF4-253H | Native Human Platelet Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PF4-3283HCL | Recombinant Human PF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PF4 Products
Required fields are marked with *
My Review for All PF4 Products
Required fields are marked with *
0
Inquiry Basket