Recombinant Pig IL8 protein

• Cat.No.: IL8-601P
• Product Overview: Recombinant Pig IL8 protein was expressed in Escherichia coli.

Specification

• Species: Pig
• Source: E.coli
• Tag: Non
• Protein Length: 78
• Description: Interleukin-8 (IL-8) is encoded by the IL8 gene and produced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles. There are many receptors capable to bind IL-8, the most affinity to IL-8 are receptors CXCR1, and CXCR2. As a member of the CXC chemokine family, function of IL-8 is the induction of chemotaxis in its target cells, like neutrophil granulocytes, basophils, and T-cells. . IL-8 is often associated with inflammation and has been cited as a proinflammatory mediator in gingivitis and psoriasis.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 20-200 ng/ml.
• Molecular Mass: Approximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids.
• AA Sequence: ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ
• Endotoxin: Less than 1 EU/μg of rPoIL-8/CXCL8 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL8
• Official Symbol: IL8
• Synonyms: IL8; interleukin 8; interleukin-8; IL-8; C-X-C motif chemokine 8; alveolar macrophage chemotactic factor I; alveolar macrophage-derived chemotactic factor-I; CXCL8; AMCF-I
• Gene ID: 396880
• mRNA Refseq: NM_213867
• Protein Refseq: NP_999032
• UniProt ID: P26894