Recombinant Pig DEFB1 protein, GST-tagged

• Cat.No.: DEFB1-6766P
• Product Overview: Recombinant Pig DEFB1 protein(O62697)(24-64aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Pig
• Source: E.coli
• Tag: GST
• Protein Length: 24-64aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.1 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK

Gene Information

• Gene Name: DEFB1 defensin, beta 1 [ Sus scrofa ]
• Official Symbol: DEFB1
• Synonyms: DEFB1; defensin, beta 1; beta-defensin 1; BD-1; prepro-beta-defensin 1; PBD-1
• Gene ID: 396819
• mRNA Refseq: NM_213838
• Protein Refseq: NP_999003