Recombinant Pig BCMA Protein, His-tagged

• Cat.No.: TNFRSF17-03P
• Product Overview: Recombinant Pig BCMA Protein(XP_020943721.1), fused to His tag, was expressed in HEK293.

Specification

• Species: Pig
• Source: HEK293
• Tag: His
• Form: Supplied as a 0.2 μm filtered solution in PBS (pH 7.4)
• Molecular Mass: The Predicted Molecular Mass is about 6 kDa.
• AA Sequence: MAQQCYQNEYFDRLLIACKPCRLRCSNTPPVTCQHYCNTMKGTNVHHHHHH
• Endotoxin: <1EU per ug (determined by the LAL method)
• Purity: >90% as determined by SDS-PAGE
• Storage: Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml

Gene Information

• Gene Name: TNFRSF17 TNF receptor superfamily member 17 [ Sus scrofa (pig) ]
• Official Symbol: TNFRSF17
• Gene ID: 100517087
• mRNA Refseq: XM_021088062.1
• Protein Refseq: XP_020943721.1