Recombinant Parietaria Judaica LTP2 Protein (32-133 aa), His-SUMO-tagged

• Cat.No.: LTP2-2414P
• Product Overview: Recombinant Parietaria Judaica (Pellitory-of-the-wall) (Parietaria diffusa) LTP2 Protein (32-133 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Parietaria Judaica
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 32-133 aa
• Description: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.3 kDa
• AA Sequence: EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: LTP2
• UniProt ID: P55958