Recombinant Mycobacterium tuberculosis (strain H37Rv) Rv1269c protein, His-tagged

• Cat.No.: Rv1269c-6743M
• Product Overview: Recombinant Mycobacterium tuberculosis (strain H37Rv) Rv1269c protein(P9WM45)(36-124aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Mycobacterium tuberculosis (strain H37Rv)
• Source: E.coli
• Tag: His
• ProteinLength: 36-124a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.0 kDa
• AASequence: ADVYGAIAYSGNGSWGRSWDYPTRAAAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDTWACN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.