Recombinant Mouse Vsir Protein, His-tagged

• Cat.No.: Vsir-7415M
• Product Overview: Recombinant mouse Vsir protein with a His tag was expressed in Sf9 cells.

Specification

• Description: Immunoregulatory receptor which inhibits the T-cell response. May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling. May stimulate MMP14-mediated MMP2 activation.
• Source: Insect cell
• Species: Mouse
• Tag: His
• Form: Liquid
• Molecular Mass: 18.8 kDa
• Protein length: 33-191
• AA Sequence: FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAALEHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Vsir V-set immunoregulatory receptor [ Mus musculus (house mouse) ]
• Official Symbol: Vsir
• Synonyms: Vsir; V-set immunoregulatory receptor; V; Die; PD-1; Dies1; PD-1H; VISTA; 4632428N05Rik; V-type immunoglobulin domain-containing suppressor of T-cell activation; V-set domain-containing immunoregulatory receptor; differentiation of ESCs 1; platelet receptor Gi24
• Gene ID: 74048
• mRNA Refseq: NM_001159572
• Protein Refseq: NP_001153044
• UniProt ID: Q9D659