Recombinant Mouse TSHB and TSHA Protein, His tagged

• Cat.No.: TSHB-TSHA-02M
• Product Overview: Recombinant Mouse TSHB and TSHA Protein, (Met1-Val138, one mutant and Ala25-Ser116) with His tag was expressed in CHO.

Specification

• Species: Mouse
• Source: CHO
• Tag: His
• ProteinLength: TSHB: Met1-Val138, one mutant
  TSHA: Ala25-Ser116
• Description: Thyroid-stimulating hormone, commonly called TSH and also referred to as thyrotropin, is a hormone that your pituitary gland releases to trigger your thyroid to produce and release its own hormones-thyroxine (T4) and triiodothyronine (T3). These two hormones are essential for maintaining your body's metabolic rate-the speed at which your body transforms the food you eat into energy and uses it.
• Molecular Mass: ~ 27 kDa
• AA Sequence: MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKRGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSVHHHHHH
  MAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSHHHHHH
• Endotoxin: < 1 EU/μg protein by LAL
• Purity: > 90% as determined by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.5 mg/mL
• Storage Buffer: Supplied in PBS buffer, pH 7.4

Gene Information

• Official Symbol: TSHB, TSHA
• Synonyms: TSHB; thyroid stimulating hormone subunit beta; TSH-B; TSH-BETA; thyrotropin subunit beta; thyroid stimulating hormone beta; thyrotropin beta chain; CGA; glycoprotein hormones, alpha polypeptide; HCG; LHA; FSHA; GPA1; GPHa; TSHA; GPHA1; CG-ALPHA; glycoprotein hormones alpha chain; FSH-alpha; LSH-alpha; TSH-alpha; anterior pituitary glycoprotein hormones common subunit alpha; choriogonadotropin alpha chain; chorionic gonadotrophin subunit alpha; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha chain; follicle-stimulating hormone alpha subunit; follitropin alpha chain; luteinizing hormone alpha chain; lutropin alpha chain; thyroid-stimulating hormone alpha chain; thyrotropin alpha chain