Recombinant Mouse Trbv13-2 Protein, GST-tagged
Cat.No. : | Trbv13-2-27M |
Product Overview : | Recombinant Mouse Recombinant Mouse Trbv13-2 Protein, fused to GST-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Description : | Acts upstream of or within cytokine-mediated signaling pathway. |
Form : | Supplied as a 0.2 μm filtered solution in 30mM Tris,300 mM NaCl,10% Glycerol, pH10.0. |
Molecular Mass : | ~38.4 kDa |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSEAVVTQSPRNKVAVTGEKVTLSKQTNSYFNNMYWYRQDTGHELRLIFMSHGIRNVEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGGGTLYFGAGTRLSVL |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.19 mg/ml |
Gene Name | Trbv13-2 T cell receptor beta, variable 13-2 [ Mus musculus (house mouse) ] |
Official Symbol | Trbv13-2 |
Synonyms | Tcrb; TCRBV8S2; Tcrb-V8.2 |
Gene ID | 100124675 |
UniProt ID | P04213 |
◆ Recombinant Proteins | ||
IL2RG-5759HF | Recombinant Full Length Human IL2RG Protein, GST-tagged | +Inquiry |
CIB1-1070R | Recombinant Rat CIB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLUL-769H | Recombinant Human Glutamate-ammonia Ligase, His-tagged | +Inquiry |
AKR1C1-121R | Recombinant Rhesus Macaque AKR1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL4-3701C | Recombinant Cynomolgus monkey IL4 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
toxB-11C | Native C. difficile toxB | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
JTB-1040HCL | Recombinant Human JTB cell lysate | +Inquiry |
TPCN2-851HCL | Recombinant Human TPCN2 293 Cell Lysate | +Inquiry |
ZNF333-2013HCL | Recombinant Human ZNF333 cell lysate | +Inquiry |
HOXA1-5430HCL | Recombinant Human HOXA1 293 Cell Lysate | +Inquiry |
JMJD8-5100HCL | Recombinant Human JMJD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Trbv13-2 Products
Required fields are marked with *
My Review for All Trbv13-2 Products
Required fields are marked with *
0
Inquiry Basket