Recombinant Mouse Trbv13-2 Protein, GST-tagged

Cat.No. : Trbv13-2-27M
Product Overview : Recombinant Mouse Recombinant Mouse Trbv13-2 Protein, fused to GST-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST
Description : Acts upstream of or within cytokine-mediated signaling pathway.
Form : Supplied as a 0.2 μm filtered solution in 30mM Tris,300 mM NaCl,10% Glycerol, pH10.0.
Molecular Mass : ~38.4 kDa
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSEAVVTQSPRNKVAVTGEKVTLSKQTNSYFNNMYWYRQDTGHELRLIFMSHGIRNVEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGGGTLYFGAGTRLSVL
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.19 mg/ml
Gene Name Trbv13-2 T cell receptor beta, variable 13-2 [ Mus musculus (house mouse) ]
Official Symbol Trbv13-2
Synonyms Tcrb; TCRBV8S2; Tcrb-V8.2
Gene ID 100124675
UniProt ID P04213

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Trbv13-2 Products

Required fields are marked with *

My Review for All Trbv13-2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon