Recombinant Mouse TNFSF4 Protein, His-tagged

Cat.No. : TNFSF4-84M
Product Overview : Recombinant Mouse OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Ser51-Leu198 is expressed with a 8His tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Human Cells
Tag : His
Protein Length : Ser51-Leu198
Description : OX40 ligand (OX40L), also called CD252, is a single-pass type II membrane protein of the TNF/TNF receptor superfamily. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40 which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival and for the generation of memory T cells from activated effector T cells. OX40L–OX40 co-stimulation leads to activation of TNF receptor associated factor (TRAF) 2, 3 and 5. This pathway has been shown to prolong the survival of effector CD4+Th cells as well as contributes to generation of memory T cells.
Form : Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
AA Sequence : HHHHHHHHSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFF QEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGY CAPEGSYHSTVNQVPL
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Quality Statement : Purity: Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name Tnfsf4 tumor necrosis factor (ligand) superfamily, member 4 [ Mus musculus (house mouse) ]
Official Symbol TNFSF4
Synonyms Tumor necrosis factor ligand superfamily member 4; CD134 ligand; CD134L; CD252; CD252 antigen; OX40 antigen ligand; OX40 ligand; OX40L; TAX transcriptionally-activated glycoprotein 1; tumor necrosis factor (ligand) superfamily, member 4; Ath1; gp34; Ath-1; Ox40l; TXGP1; OX-40L; Tnlg2b; Txgp1l
Gene ID 22164
mRNA Refseq NM_009452.2
Protein Refseq NP_033478.1
UniProt ID P43488

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNFSF4 Products

Required fields are marked with *

My Review for All TNFSF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon