Recombinant Mouse TNFSF4 Protein, His-tagged
Cat.No. : | TNFSF4-84M |
Product Overview : | Recombinant Mouse OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Ser51-Leu198 is expressed with a 8His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Human Cells |
Tag : | His |
Protein Length : | Ser51-Leu198 |
Description : | OX40 ligand (OX40L), also called CD252, is a single-pass type II membrane protein of the TNF/TNF receptor superfamily. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40 which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival and for the generation of memory T cells from activated effector T cells. OX40L–OX40 co-stimulation leads to activation of TNF receptor associated factor (TRAF) 2, 3 and 5. This pathway has been shown to prolong the survival of effector CD4+Th cells as well as contributes to generation of memory T cells. |
Form : | Lyophilized from a 0.2 um filtered solution of PBS, pH7.4. |
AA Sequence : | HHHHHHHHSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFF QEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGY CAPEGSYHSTVNQVPL |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | Tnfsf4 tumor necrosis factor (ligand) superfamily, member 4 [ Mus musculus (house mouse) ] |
Official Symbol | TNFSF4 |
Synonyms | Tumor necrosis factor ligand superfamily member 4; CD134 ligand; CD134L; CD252; CD252 antigen; OX40 antigen ligand; OX40 ligand; OX40L; TAX transcriptionally-activated glycoprotein 1; tumor necrosis factor (ligand) superfamily, member 4; Ath1; gp34; Ath-1; Ox40l; TXGP1; OX-40L; Tnlg2b; Txgp1l |
Gene ID | 22164 |
mRNA Refseq | NM_009452.2 |
Protein Refseq | NP_033478.1 |
UniProt ID | P43488 |
◆ Recombinant Proteins | ||
TNFSF4-5644H | Recombinant Human TNFSF4 protein, His-Flag-tagged | +Inquiry |
TNFSF4-0587R | Active Recombinant Rabbit TNFSF4 protein, His-tagged | +Inquiry |
TNFSF4-27254TH | Active Recombinant Human TNFSF4 | +Inquiry |
TNFSF4-5861R | Recombinant Rat TNFSF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF4-142H | Recombinant Human TNFSF4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF4-857CCL | Recombinant Cynomolgus TNFSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF4 Products
Required fields are marked with *
My Review for All TNFSF4 Products
Required fields are marked with *
0
Inquiry Basket