Recombinant Mouse TNFSF4 Protein, His-tagged

• Cat.No.: TNFSF4-84M
• Product Overview: Recombinant Mouse OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Ser51-Leu198 is expressed with a 8His tag at the N-terminus.

Specification

• Species: Mouse
• Source: Human Cells
• Tag: His
• Protein Length: Ser51-Leu198
• Description: OX40 ligand (OX40L), also called CD252, is a single-pass type II membrane protein of the TNF/TNF receptor superfamily. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40 which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival and for the generation of memory T cells from activated effector T cells. OX40L–OX40 co-stimulation leads to activation of TNF receptor associated factor (TRAF) 2, 3 and 5. This pathway has been shown to prolong the survival of effector CD4+Th cells as well as contributes to generation of memory T cells.
• Form: Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
• AA Sequence: HHHHHHHHSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFF QEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGY CAPEGSYHSTVNQVPL
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: Tnfsf4 tumor necrosis factor (ligand) superfamily, member 4 [ Mus musculus (house mouse) ]
• Official Symbol: TNFSF4
• Synonyms: Tumor necrosis factor ligand superfamily member 4; CD134 ligand; CD134L; CD252; CD252 antigen; OX40 antigen ligand; OX40 ligand; OX40L; TAX transcriptionally-activated glycoprotein 1; tumor necrosis factor (ligand) superfamily, member 4; Ath1; gp34; Ath-1; Ox40l; TXGP1; OX-40L; Tnlg2b; Txgp1l
• Gene ID: 22164
• mRNA Refseq: NM_009452.2
• Protein Refseq: NP_033478.1
• UniProt ID: P43488