Recombinant Mouse TNFSF14 protein

• Cat.No.: TNFSF14-2020M
• Product Overview: Recombinant Mouse TNFSF14 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• ProteinLength: 168
• Description: The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using human HT-29 cells is less than 2 μg/ml, corresponding to a specific activity of > 500 IU/mg in the presence of murine anti-polyHistidine monoclonal antibody and rHuIFN-γ.
• Molecular Mass: Approximately 18.4 kDa, a single non-glycosylated polypeptide chain containing 168 amino acids.
• AA Sequence: DGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV
• Endotoxin: Less than 1 EU/µg of rMuLIGHT/TNFSF14 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 100 mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TNFSF14
• Official Symbol: TNFSF14
• Synonyms: TNFSF14; tumor necrosis factor (ligand) superfamily, member 14; tumor necrosis factor ligand superfamily member 14; LTg; HVEML; LIGHT; Ly113; HVEM-L
• Gene ID: 50930
• mRNA Refseq: NM_019418
• Protein Refseq: NP_062291
• UniProt ID: Q9QYH9