Recombinant Mouse Tnfsf11 protein, His-SUMO-tagged

• Cat.No.: Tnfsf11-3604M
• Product Overview: Recombinant Mouse Tnfsf11 protein(O35235)(70-316aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 70-316aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.9 kDa
• AA Sequence: YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Tnfsf11 tumor necrosis factor (ligand) superfamily, member 11 [ Mus musculus ]
• Official Symbol: Tnfsf11
• Synonyms: TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; OPG ligand; osteoprotegerin ligand; osteoclast differentiation factor; receptor activator of NF-kappaB ligand; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor-related activation-induced cytokine; ODF; OPG; OPGL; RANKL; Ly109l; Trance
• Gene ID: 21943
• mRNA Refseq: NM_011613
• Protein Refseq: NP_035743